Heterochromatin Protein 1, Binding Protein 3 (HP1BP3) (Middle Region) antibody

Details for Product No. ABIN504113
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Hp1bp74, HP1-BP74
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(5), (1)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504113
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HP1BP3
Sequence QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTF QLKKSGEKPL
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against HP1BP3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HP1BP3
Background HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.
Molecular Weight 61 kDa
Gene ID 50809
NCBI Accession NM_016287, NP_057371
UniProt Q5SSJ5
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 553 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Heterochromatin Protein 1, Binding Protein 3 (HP1BP3) (Middle Region) antibody WB Suggested Anti-HP1BP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (6), (1)
Reactivities (5), (1)
Applications (7), (1), (1)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top