Chromosome X Open Reading Frame 26 (CXorf26) (Middle Region) antibody

Details for Product No. ABIN504127
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CXorf26, 2610029G23Rik, MGC86379, CXHXorf26
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
(14), (1), (1)
Host
Rabbit
(8), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (6), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN504127
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CXorf26
Sequence KFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIE IARNREGYNK
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against CXorf26. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CXorf26
Background The function of this protein remains unknown.
Molecular Weight 26 kDa
Gene ID 51260
NCBI Accession NM_016500, NP_057584
UniProt Q9BVG4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 233 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome X Open Reading Frame 26 (CXorf26) (Middle Region) antibody WB Suggested Anti-CXorf26 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart
Background publications Cheng, Kapranov, Drenkow et al.: "Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution." in: Science (New York, N.Y.), Vol. 308, Issue 5725, pp. 1149-54, 2005 (PubMed).

Hosts (8), (6)
Reactivities (14), (1), (1)
Applications (15), (6), (4), (2), (2), (1)
Epitopes (2), (1)
back to top