Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504127

Chromosome X Open Reading Frame 26 (CXorf26) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CXorf26, 2610029G23Rik, MGC86379, CXHXorf26
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504127
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CXorf26 antibody: synthetic peptide directed towards the middle region of human CXorf26
Sequence KFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIE IARNREGYNK
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against CXorf26. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CXorf26
Background The function of this protein remains unknown.
Molecular Weight 26kDa
Gene ID 51260
NCBI Accession NP_057584, NM_016500
UniProt Q9BVG4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CXorf26 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cheng, Kapranov, Drenkow et al.: "Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution." in: Science (New York, N.Y.), Vol. 308, Issue 5725, pp. 1149-54, 2005 (PubMed).

Alternatives for antigen "Chromosome X Open Reading Frame 26 (CXorf26)", type "Antibodies"
Hosts (7), (6)
Reactivities (13), (1), (1)
Applications (14), (6), (4), (3), (2), (1)
Epitopes (2), (1)
Beacon