Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504134

Microfibrillar Associated Protein 2 (MFAP2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MAGP, MAGP-1, MAGP1, AI893631, Magp, Magp1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504134
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MFAP2 antibody: synthetic peptide directed towards the N terminal of human MFAP2
Sequence MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSD QIDNPDYYDY
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Guinea pig : 91%
Characteristics This is a rabbit polyclonal antibody against MFAP2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MFAP2
Background Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for
Molecular Weight 19kDa
Gene ID 4237
NCBI Accession NP_059453, NM_016282
UniProt P55001
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MFAP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "Microfibrillar Associated Protein 2 (MFAP2)", type "Antibodies"
Hosts (9), (3)
Reactivities (9), (1), (1), (1)
Applications (12), (5), (3), (2), (1), (1), (1)
Epitopes (6), (2), (2), (1), (1)
Beacon