Did you know that you can buy products from over 140 different suppliers from us?

Proteasome (Prosome, Macropain) Subunit, alpha Type, 3 (PSMA3) (Middle Region) antibody

Details for Product No. ABIN504342
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HC8, PSC3, Psma3l, im:6909944, zgc:114044, Lmpc8, psma3
Epitope
Middle Region
(2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Human, Chicken
(17), (8), (8), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(18)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (7), (5), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504342
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PSMA3
Sequence TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRH EIVPKDIREE
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, African clawed frog : 90 %, Chicken : 90 %, Rabbit : 90 %, Rat : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against PSMA3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PSMA3
Background The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Molecular Weight 28 kDa
Gene ID 5684
NCBI Accession NM_152132, NP_687033
UniProt P25788-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 248 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proteasome (Prosome, Macropain) Subunit, alpha Type, 3 (PSMA3) (Middle Region) antibody WB Suggested Anti-PSMA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504342
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top