Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504383

Ret Finger Protein-Like 3 (RFPL3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RFPL3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504383
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RFPL3 antibody: synthetic peptide directed towards the middle region of human RFPL3
Sequence VYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGT TDAPVRPGEA
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against RFPL3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RFPL3
Background The function remains unknown.
Molecular Weight 35kDa
Gene ID 10738
NCBI Accession NP_001092005, NM_004852
UniProt O75679
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RFPL3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rauch, Li, Wu et al.: "MIRA-assisted microarray analysis, a new technology for the determination of DNA methylation patterns, identifies frequent methylation of homeodomain-containing genes in lung cancer cells." in: Cancer research, Vol. 66, Issue 16, pp. 7939-47, 2006 (PubMed).

Alternatives for antigen "Ret Finger Protein-Like 3 (RFPL3)", type "Antibodies"
Hosts (11), (7)
Reactivities (16)
Applications (17), (6), (2), (1), (1), (1), (1)
Epitopes (2), (2), (2), (2), (1), (1)
Beacon