Did you know that you can buy products from over 140 different suppliers from us?

Ret Finger Protein-Like 3 (RFPL3) (Middle Region) antibody

Details for Product No. ABIN504383
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RFPL3
Epitope
Middle Region
(3), (2), (2), (2), (1), (1)
Reactivity
Human
(17)
Host
Rabbit
(12), (7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (6), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504383
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RFPL3
Sequence VYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGT TDAPVRPGEA
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against RFPL3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RFPL3
Background The function remains unknown.
Molecular Weight 35 kDa
Gene ID 10738
NCBI Accession NM_004852, NP_001092005
UniProt O75679
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 317 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ret Finger Protein-Like 3 (RFPL3) (Middle Region) antibody WB Suggested Anti-RFPL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate
Background publications Rauch, Li, Wu et al.: "MIRA-assisted microarray analysis, a new technology for the determination of DNA methylation patterns, identifies frequent methylation of homeodomain-containing genes in lung cancer cells." in: Cancer research, Vol. 66, Issue 16, pp. 7939-47, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504383
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top