Did you know that you can buy products from over 140 different suppliers from us?

Tripartite Motif Containing 31 (TRIM31) (Middle Region) antibody

Details for Product No. ABIN504384
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Trim31l, TRIM31, C6orf13, HCG1, HCGI, RNF, BC026666
Epitope
Middle Region
(7), (6), (3), (2), (2), (2), (1)
Reactivity
Human
(31), (1), (1)
Host
Rabbit
(26), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (10), (10), (4), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504384
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRIM31
Sequence HSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDV ALSEELHAAL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against TRIM31. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIM31
Background TRIM31 encodes for a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus.
Molecular Weight 48 kDa
Gene ID 11074
NCBI Accession NM_001098535, NP_008959
UniProt Q9BZY9
Research Area Cancer
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 425 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 31 (TRIM31) (Middle Region) antibody WB Suggested Anti-TRIM31 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Validation Images
back to top