Vestigial Like 1 (Drosophila) (VGLL1) (Middle Region) antibody

Details for Product No. ABIN504406
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms TDU, VGL1, RGD1564038, Tondu, VGLL1, vgl1
Epitope
Middle Region
(3), (2), (2), (1), (1)
Reactivity
Human
(23), (2)
Host
Rabbit
(19), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (10), (6), (3), (3), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN504406
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human VGLL1
Sequence RPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSR GSASTSLPNE
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against VGLL1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name VGLL1
Background VGLL1 is a specific coactivator for the mammalian TEFs. The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed.
Molecular Weight 29 kDa
Gene ID 51442
NCBI Accession NM_016267, NP_057351
UniProt Q99990
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 258 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Vestigial Like 1 (Drosophila) (VGLL1) (Middle Region) antibody WB Suggested Anti-VGLL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (19), (5)
Reactivities (23), (2)
Applications (15), (10), (6), (3), (3), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1)
back to top