Did you know that you can buy products from over 140 different suppliers from us?

Short Stature Homeobox 2 (SHOX2) (Middle Region) antibody

Details for Product No. ABIN504409
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SHOX2, og12, shot, og12x, ogi2x, OG12, OG12X, SHOT, 6330543G17Rik, Og12x, Prx3, zgc:65884, zgc:77344
Epitope
Middle Region
(7), (4), (3), (3), (2), (2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(24), (5), (5), (2), (2), (2)
Host
Rabbit
(13), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (10), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504409
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SHOX2
Sequence PGSPRLTEVSPELKDRKEDAKGMEDEGQTKIKQRRSRTNF TLEQLNELER
Predicted Reactivity Bovine : 100 %, Human : 100 %, Rat : 100 %, Dog : 90 %, Mouse : 90 %
Characteristics This is a rabbit polyclonal antibody against SHOX2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SHOX2
Background SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.
Molecular Weight 35 kDa
Gene ID 6474
NCBI Accession NM_006884, NP_006875
UniProt O60902
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 331 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Short Stature Homeobox 2 (SHOX2) (Middle Region) antibody WB Suggested Anti-SHOX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Product cited in: Hillman, Green, Brenner: "An unappreciated role for RNA surveillance." in: Genome biology, Vol. 5, Issue 2, pp. R8, 2004 (PubMed).

Validation Images
back to top