Zinc Finger Protein 174 (ZNF174) (Middle Region) antibody

Details for Product No. ABIN504418
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Znf174, ZSCAN8, Gm1754, ZNF174
Epitope
Middle Region
(4), (3), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Dog (Canine), Cow (Bovine), Human
(32)
Host
Rabbit
(21), (11)
Clonality
Polyclonal
Application
Western Blotting (WB)
(29), (15), (13), (6), (3), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN504418
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF174
Sequence DNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMS EPRLSRRQVS
Predicted Reactivity Pig : 85 %, Guinea pig : 85 %, Bovine : 75 %, Dog : 75 %, Rabbit : 75 %
Characteristics This is a rabbit polyclonal antibody against ZNF174. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF174
Background Zinc finger protein 174.
Molecular Weight 46 kDa
Gene ID 7727
NCBI Accession NM_003450, NP_003441
UniProt Q15697
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 407 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 174 (ZNF174) (Middle Region) antibody WB Suggested Anti-ZNF174 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Hosts (21), (11)
Reactivities (32)
Applications (29), (15), (13), (6), (3), (2), (2), (2)
Epitopes (4), (3), (2), (2), (1), (1), (1), (1), (1)
back to top