Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504418

Zinc Finger Protein 174 (ZNF174) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Znf174, ZSCAN8, Gm1754, ZNF174
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504418
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF174 antibody: synthetic peptide directed towards the middle region of human ZNF174
Sequence DNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMS EPRLSRRQVS
Predicted Reactivity Pig : 85%, Guinea pig : 83%, Bovine : 78%, Dog : 78%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against ZNF174. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF174
Background Zinc finger protein 174.
Molecular Weight 46kDa
Gene ID 7727
NCBI Accession NP_003441, NM_003450
UniProt Q15697
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF174 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 174 (ZNF174)", type "Antibodies"
Hosts (17), (11)
Reactivities (28)
Applications (25), (12), (11), (4), (2), (2), (2), (1)
Epitopes (5), (3), (2), (1), (1), (1), (1), (1)
Beacon