Plexin A4 (PLXNA4) (Middle Region) antibody

Details for Product No. ABIN504484
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms FAYV2820, PLEXA4, PLXNA4A, PLXNA4B, PRO34003, 9330117B14, Plxa4, mKIAA1550, Plxna4, PLEX2, PLXNA4, D204, wu:fd49b01, wu:fe15f03
Epitope
Middle Region
(1), (1), (1)
Reactivity
Human
(18), (12), (12), (12), (12), (12)
Host
Rabbit
(16), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (4), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504484
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PLXNA4
Sequence TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRV QPLLCCFLNV
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against PLXNA4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PLXNA4
Background This protein mediates semaphorin receptor activity.
Molecular Weight 57 kDa
Gene ID 91584
NCBI Accession NM_181775, NP_861440
UniProt A4D1N6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 522 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Plexin A4 (PLXNA4) (Middle Region) antibody WB Suggested Anti-PLXNA4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Hosts (16), (2), (1)
Reactivities (18), (12), (12), (12), (12), (12)
Applications (10), (9), (4), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
back to top