Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504498

Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
G3PD, GAPD, Gapd, cb609, gapd, mg:bb02e05, wu:fb33a10, wu:ft80f05, KNC-NDS6, G3PDH, CG8893, Dmel\\CG8893, GA3PDH, GADPH, GAP, GAPDH, GAPDH II, GAPDH2, Gapdh, Gapdh-2, Gapdh13F, BEST:GH12586, CG12055,  ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504498
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GAPDH antibody: synthetic peptide directed towards the middle region of human GAPDH
Sequence KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKI ISNASCTTNC
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against GAPDH. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GAPDH
Background GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a
Molecular Weight 36kDa
Gene ID 2597
NCBI Accession NP_002037, NM_002046
UniProt P04406
Research Area Cancer, Metabolism, Alzheimer's Disease, Enzymes
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GAPDH antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rinne, Clements, Lamme et al.: "A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes." in: Human molecular genetics, Vol. 17, Issue 13, pp. 1968-77, 2008 (PubMed).

Alternatives for antigen "Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH)", type "Antibodies"
Hosts (249), (200), (37), (22), (20)
Reactivities (398), (245), (212), (108), (59), (39), (38), (36), (27), (26), (24), (20), (16), (14), (13), (11), (10), (9), (7), (6), (6), (6), (6), (6), (5), (5), (5), (5), (5), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (446), (238), (140), (81), (79), (60), (50), (37), (17), (13), (7), (6), (5), (5), (4), (2), (2), (1), (1)
Conjugates (30), (24), (7), (7), (6), (6), (5), (5), (5), (5), (5), (5), (5), (5), (2), (2), (1), (1)
Epitopes (82), (34), (11), (10), (6), (6), (5), (5), (5), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1)
Beacon