Thrombopoietin (THPO) (Middle Region) antibody

Details for Product No. ABIN504524
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms MGDF, MKCSF, ML, MPLLG, THCYT1, TPO, Ml, Tpo, Mgdf, Tpo1, Tpo2, Tpo3, Tpo4, Mpllg, tpo, LOC100231762
Epitope
Middle Region
(3), (3), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Dog (Canine), Human
(60), (33), (16), (14), (2), (1), (1), (1)
Host
Rabbit
(49), (22), (18), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(6), (4), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(72), (62), (20), (17), (10), (10), (6), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1)
Pubmed 2 references available
Catalog no. ABIN504524
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human THPO
Sequence NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPD PSAPTPTPTS
Predicted Reactivity Cat :100 %,   Human :100 %,   Dog :80 %,  
Characteristics This is a rabbit polyclonal antibody against THPO. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name THPO
Background Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.
Molecular Weight 35 kDa
Gene ID 7066
NCBI Accession NM_000460, NP_000451
UniProt P40225
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 353 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Thrombopoietin (THPO) (Middle Region) antibody WB Suggested Anti-THPO Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Product cited in: Baker, Gray, Wright et al.: "The effect of a pedometer-based community walking intervention "Walking for Wellbeing in the West" on physical activity levels and health outcomes: a 12-week randomized controlled trial." in: The international journal of behavioral nutrition and physical activity, Vol. 5, pp. 44, 2008 (PubMed).

Background publications Baker, Su, Hsu et al.: "Human thrombopoietin reduces myocardial infarct size, apoptosis, and stunning following ischaemia/reperfusion in rats." in: Cardiovascular research, Vol. 77, Issue 1, pp. 44-53, 2008 (PubMed).

Hosts (49), (22), (18), (6)
Reactivities (60), (33), (16), (14), (2), (1), (1), (1)
Applications (72), (62), (20), (17), (10), (10), (6), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1)
Conjugates (6), (4), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (3), (2), (2), (2), (1), (1), (1)
back to top