Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504524

Thrombopoietin (THPO) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGDF, MKCSF, ML, MPLLG, THCYT1, TPO, Ml, Tpo, Mgdf, Tpo1, Tpo2, Tpo3, Tpo4, Mpllg, tpo, LOC100231762
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN504524
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO
Sequence NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPD PSAPTPTPTS
Predicted Reactivity Cat :100%,   Human :100%,   Dog :83%,  
Characteristics This is a rabbit polyclonal antibody against THPO. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name THPO
Background Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.
Molecular Weight 35kDa
Gene ID 7066
NCBI Accession NP_000451, NM_000460
UniProt P40225
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-THPO antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Baker, Gray, Wright et al.: "The effect of a pedometer-based community walking intervention "Walking for Wellbeing in the West" on physical activity levels and health outcomes: a 12-week randomized controlled trial." in: The international journal of behavioral nutrition and physical activity, Vol. 5, pp. 44, 2008 (PubMed).

Background publications Baker, Su, Hsu et al.: "Human thrombopoietin reduces myocardial infarct size, apoptosis, and stunning following ischaemia/reperfusion in rats." in: Cardiovascular research, Vol. 77, Issue 1, pp. 44-53, 2008 (PubMed).

Alternatives for antigen "Thrombopoietin (THPO)", type "Antibodies"
Hosts (45), (23), (19), (10)
Reactivities (67), (36), (14), (12)
Applications (69), (62), (10), (9), (6), (5), (5), (3), (2), (2), (2), (2), (2), (2), (1), (1)
Conjugates (9), (5), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1)
Beacon