Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504554

Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (E2IG3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C77032, E2IG3, NNP47, NS, BC037996, Ns, e2ig3, wu:fc55d07, id:ibd2914, nstm, wu:fb38a04, zgc:123093
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504554
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3
Sequence MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPN SAPFKEALLR
Predicted Reactivity Horse : 100%, Human : 100%, Mouse : 100%, Bovine : 92%, Chicken : 92%, Rat : 92%, Dog : 85%, Guinea pig : 85%, Pig : 85%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against GNL3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GNL3
Background GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.
Molecular Weight 60kDa
Gene ID 26354
NCBI Accession NP_996561, NM_206825
UniProt Q9BVP2-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GNL3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ma, Pederson: "Depletion of the nucleolar protein nucleostemin causes G1 cell cycle arrest via the p53 pathway." in: Molecular biology of the cell, Vol. 18, Issue 7, pp. 2630-5, 2007 (PubMed).

Alternatives for antigen "Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (E2IG3)", type "Antibodies"
Hosts (36), (11), (3), (1)
Reactivities (46), (16), (11), (11), (11), (11)
Applications (40), (22), (9), (6), (4), (4), (3), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (5), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon