Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504561

CSE1 Chromosome Segregation 1-Like (Yeast) (CSE1L) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAS, CSE1, XPO2, Exportin-2, 2610100P18Rik, AA407533, Capts, Cas, Xpo2, cas, xpo2, BcDNA:LD14270, CG13281, Dcas, Dmel\\CG13281, dcas, l(2)k03902, CSE1L, DKFZp459E1929
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504561
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CSE1L antibody: synthetic peptide directed towards the N terminal of human CSE1L
Sequence ELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQN YPLLLLTLLE
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, Chicken : 86%
Characteristics This is a rabbit polyclonal antibody against CSE1L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CSE1L
Background Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. CSE1L binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the protein may play a role both in apoptosis and in cell proliferation.Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.
Molecular Weight 110kDa
Gene ID 1434
NCBI Accession NP_001307, NM_001316
UniProt P55060
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CSE1L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kim, Jiang, Du et al.: "PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1." in: Molecular cell, Vol. 30, Issue 2, pp. 239-47, 2008 (PubMed).

Alternatives for antigen "CSE1 Chromosome Segregation 1-Like (Yeast) (CSE1L)", type "Antibodies"
Hosts (44), (28)
Reactivities (69), (25), (22), (12), (12), (1), (1)
Applications (62), (36), (30), (25), (12), (10), (7), (6), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (9), (3), (1), (1)
Beacon