Did you know that you can buy products from over 140 different suppliers from us?

CSE1 Chromosome Segregation 1-Like (Yeast) (CSE1L) (N-Term) antibody

Details for Product No. ABIN504561
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BcDNA:LD14270, CAS, CG13281, Dcas, Dmel\\CG13281, cas, dcas, l(2)k03902, CSE1L, XPO2, Exportin-2, DKFZp459E1929, 2610100P18Rik, AA407533, Capts, Cas, Xpo2, xpo2, CSE1
Epitope
N-Term
(14), (14), (9), (3), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Xenopus laevis, Human, Chicken
(81), (23), (20), (12), (12), (1), (1)
Host
Rabbit
(46), (38), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(73), (40), (28), (26), (12), (11), (10), (8), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504561
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CSE1L
Sequence ELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQN YPLLLLTLLE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against CSE1L. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CSE1L
Background Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. CSE1L binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the protein may play a role both in apoptosis and in cell proliferation.Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.
Molecular Weight 110 kDa
Gene ID 1434
NCBI Accession NM_001316, NP_001307
UniProt P55060
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 971 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Kim, Jiang, Du et al.: "PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1." in: Molecular cell, Vol. 30, Issue 2, pp. 239-47, 2008 (PubMed).

Validation Images
back to top