Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504597

Cyclin E2 (CCNE2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms cyce2, CYCE2, ccne2, MGC53684, MGC132360, cb165, sb:cb165, zgc:86724, CCNE2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504597
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCNE2 antibody: synthetic peptide directed towards the N terminal of human CCNE2
Sequence TTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIET PHKEIGTSDF
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Pig : 92%, Mouse : 91%, Rat : 91%, Guinea pig : 84%
Characteristics This is a rabbit polyclonal antibody against CCNE2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCNE2
Background The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
Molecular Weight 47kDa
Gene ID 9134
NCBI Accession NP_477097, NM_057749
UniProt O96020
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCNE2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Li, Santockyte, Shen et al.: "A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers." in: Archives of biochemistry and biophysics, Vol. 453, Issue 1, pp. 70-4, 2006 (PubMed).

Alternatives for antigen "Cyclin E2 (CCNE2)", type "Antibodies"
Hosts (68), (3), (1)
Reactivities (66), (30), (16), (12), (12), (2), (2), (1)
Applications (48), (25), (20), (12), (11), (8), (5), (3), (2), (2), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (16), (7), (5), (4), (1), (1)
Beacon