Cyclin E2 (CCNE2) (N-Term) antibody

Details for Product No. ABIN504597
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ccne2, MGC53684, MGC132360, cb165, sb:cb165, zgc:86724, CCNE2, cyce2, CYCE2
Epitope
N-Term
(17), (9), (7), (4), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(65), (31), (17), (12), (12), (7), (1)
Host
Rabbit
(71), (3), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(49), (23), (20), (15), (15), (8), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504597
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CCNE2
Sequence TTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIET PHKEIGTSDF
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Pig : 90 %, Mouse : 90 %, Rat : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against CCNE2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CCNE2
Background The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
Molecular Weight 47 kDa
Gene ID 9134
NCBI Accession NM_057749, NP_477097
UniProt O96020
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 404 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cyclin E2 (CCNE2) (N-Term) antibody WB Suggested Anti-CCNE2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate
anti-Cyclin E2 (CCNE2) (N-Term) antibody (2) WB Suggested Anti-CCNE2
Antibody Titration: 0.2-1 µg/mL ELISA Titer: 1:.12500
Positive Control: OVCAR-3 cell lysate
CCNE2 is supported by BioGPS gene expression data to be expressed in OVCAR3
Background publications Li, Santockyte, Shen et al.: "A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers." in: Archives of biochemistry and biophysics, Vol. 453, Issue 1, pp. 70-4, 2006 (PubMed).

Validation Images
back to top