T-Cell Acute Lymphocytic Leukemia 2 (TAL2) (Middle Region) antibody

Details for Product No. ABIN504634
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tail2, zgc:111884, bHLHa19
Epitope
Middle Region
(2), (2), (1), (1)
Reactivity
Human
(6), (4), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(7), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504634
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TAL2
Sequence LGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQ VPSPGPSHHI
Cross-Reactivity Human
Predicted Reactivity Human : 100 %, Bovine : 70 %
Purification Affinity Purified
Alternative Name TAL2
Background TAL2 is a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia.
Molecular Weight 12 kDa
NCBI Accession NM_005421, NP_005412
UniProt Q16559
Research Area Cancer, Transcription Factors
Application Notes WB Suggested Anti-TAL2 Antibody Titration: 0.2-1 µg/mL
ELISA Titer: 1:312500
Positive Control: Human Spleen.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 108 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-T-Cell Acute Lymphocytic Leukemia 2 (TAL2) (Middle Region) antibody WB Suggested Anti-TAL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Validation Images
back to top