Transcription Factor Dp-1 (TFDP1) (Middle Region) antibody

Details for Product No. ABIN504665
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms DP1, Dp-1, DRTF1, Dp1, Drtf1, hm:zeh1183, tfdp1, zeh1183, zgc:73281, dp-1, dp1, drtf1, tfdp1a, tfdp1l, wu:fb94b07, wu:fc52a06, zgc:55487, TFDP1
Epitope
Middle Region
(4), (3), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish
(58), (24), (22), (15), (12), (12), (12), (2), (1)
Host
Rabbit
(34), (25)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(48), (21), (12), (11), (10), (10), (4), (3), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504665
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TFDP1
Sequence FSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDE EDDDFNENDE
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Chicken : 100 %, Human : 100 %, Mouse : 100 %, African clawed frog : 90 %, Bovine : 90 %, Zebrafish : 80 %
Characteristics Antigen Size: 410 amino acids
Purification Affinity Purified
Alternative Name TFDP1
Background The E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells. The E2F transcription factor family (see MIM 189971) regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors, see TFDP2 (MIM 602160).
Molecular Weight 45 kDa
NCBI Accession NM_007111, NP_009042
UniProt Q14186
Application Notes WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 µg/mL
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 410 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Transcription Factor Dp-1 (TFDP1) (Middle Region) antibody WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate
Background publications Datta, Sen, Hagen et al.: "ARF directly binds DP1: interaction with DP1 coincides with the G1 arrest function of ARF." in: Molecular and cellular biology, Vol. 25, Issue 18, pp. 8024-36, 2005 (PubMed).

Hosts (34), (25)
Reactivities (58), (24), (22), (15), (12), (12), (12), (2), (1)
Applications (48), (21), (12), (11), (10), (10), (4), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (1), (1), (1), (1), (1)
back to top