Did you know that you can buy products from over 140 different suppliers from us?

Cold Shock Domain Protein A (CSDA) (C-Term) antibody

Details for Product No. ABIN504671
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms contrin, csda, csda-A, csda3, dbpc, frgy2, msy2, p54, ZONAB, dpbA, CSDA, CSDA1, DBPA, Csda, Dbpa, Yb2, Dpba, MSY3, MSY4, dbpA, oxyR
Epitope
C-Term
(8), (8), (4), (3), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Human
(49), (17), (14), (14), (14), (12), (3)
Host
Rabbit
(38), (14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(43), (18), (10), (8), (5), (4), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504671
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CSDA
Sequence RYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGY RRPYNYRRRP
Cross-Reactivity Human
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Guinea pig : 90 %, Mouse : 90 %, Rat : 90 %
Purification Affinity Purified
Alternative Name DNA-binding protein A
Background Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.
Molecular Weight 40 kDa
NCBI Accession NM_003651, NP_003642
UniProt P16989
Application Notes WB Suggested Anti-CSDA Antibody Titration: 0.2-1 µg/mL
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 372 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Cold Shock Domain Protein A (CSDA) (C-Term) antibody WB Suggested Anti-CSDA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Validation Images
back to top