ABI2 antibody (Abl-Interactor 2)

Details for Product anti-ABI2 Antibody No. ABIN5074816, Supplier: Log in to see
Antigen
  • ABI-2
  • ABI2B
  • AIP-1
  • AblBP3
  • SSH3BP2
  • argBPIA
  • argBPIB
  • 8430425M24Rik
  • AI839867
  • C130078H13
  • abl-interactor 2
  • ABI2
  • abi2
  • Abi2
Reactivity
Human
43
22
11
3
3
2
2
2
2
1
1
1
1
Host
Rabbit
39
4
Clonality
Polyclonal
Conjugate
This ABI2 antibody is un-conjugated
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
41
21
15
10
4
1
1
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Alternative Name ABI2 (ABI2 Antibody Abstract)
Background Gene Symbol: ABI2
Gene ID 10152
Research Area Cancer
Application Notes Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Abl-Interactor 2 (ABI2) antibody (ABIN5074816) Immunocytochemistry/Immunofluorescence: ABI2 Antibody - Staining of human cell line ...
Western Blotting (WB) image for anti-Abl-Interactor 2 (ABI2) antibody (ABIN5074816) Western Blot: ABI2 Antibody - Western blot analysis in human cell line RT-4.
Did you look for something else?