Transmembrane Protein 48 (TMEM48) antibody

Details for Product No. ABIN5080226, Supplier: Log in to see
  • tmem48
  • wu:fk93f04
  • zgc:55636
  • NET3
  • TMEM48
  • 2810475A17Rik
  • AI450313
  • Tmem48
  • NDC1 transmembrane nucleoporin
  • transmembrane protein 48
  • ndc1
  • NDC1
  • Ndc1
  • TMEM48
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRRGPRLWTSASDQQMTEFSNPSPSTSISAE
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Alternative Name TMEM48 (TMEM48 Antibody Abstract)
Background Gene Symbol: TMEM48
Gene ID 55706
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Transmembrane Protein 48 (TMEM48) antibody (ABIN5080226) Immunocytochemistry/Immunofluorescence: TMEM48 Antibody - Staining of human cell lin...
Did you look for something else?