Tpp2 antibody (Tripeptidyl Peptidase II)

Details for Product anti-Tpp2 Antibody No. ABIN5080308, Supplier: Log in to see
Antigen
  • CG3991
  • Dmel\\CG3991
  • TPP II
  • TPP2
  • TPPII
  • anon-WO0118547.127
  • dTPP II
  • dTPPII
  • l(2)k14301
  • MGC83244
  • T13K14.10
  • T13K14_10
  • tripeptidyl peptidase ii
  • DKFZp468E2313
  • TPP-2
  • TppII
  • tripeptidyl-peptidase II
  • tripeptidyl peptidase II
  • tripeptidyl peptidase ii
  • TppII
  • TPP2
  • tpp2
  • AaeL_AAEL007174
  • AaeL_AAEL009516
  • AaeL_AAEL010192
  • LOC100359134
  • Tpp2
Reactivity
Human
14
10
10
2
2
1
1
1
1
Host
Rabbit
13
1
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
14
9
5
4
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEKERMKRLNEIVDAANAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHTQAQDGAISTDAEGKEEEGESPLDSLAETFWETTKWTD
Isotype IgG
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Alternative Name Tripeptidyl peptidase II (Tpp2 Antibody Abstract)
Background Gene Symbol: TPP2
Gene ID 7174
Research Area Adaptive Immunity, Proteolysis / Ubiquitin
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Supplier Images
Immunofluorescence (IF) image for anti-Tripeptidyl Peptidase II (Tpp2) antibody (ABIN5080308) Immunocytochemistry/Immunofluorescence: Tripeptidyl peptidase II Antibody - Staining...
Did you look for something else?