ADAM28 antibody (N-Term)

Catalog No. ABIN5518723

Product Details anti-ADAM28 Antibody

Target: ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))

Binding Specificity: AA 207-248, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM28 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 28(ADAM28) detection. Tested with WB in Human.

Sequence: EYYLVLDNGE FKRYNENQDE IRKRVFEMAN YVNMLYKKLN TH

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 28(ADAM28) detection. Tested with WB in Human.
Gene Name: ADAM metallopeptidase domain 28
Protein Name: Disintegrin and metalloproteinase domain-containing protein 28

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM28 (207-248aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH), different from the related mouse sequence by eleven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ADAM28

Target: ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))

Alternative Name: ADAM28 (ADAM28 Products)

Synonyms: C130072N01Rik antibody, D430033C21Rik antibody, Dtgn1 antibody, MDC-L antibody, MDC-Lm antibody, MDC-Ls antibody, MDCL antibody, TECADAM antibody, eMDCII antibody, ADAM 28 antibody, ADAM23 antibody, eMDC II antibody, ADAM metallopeptidase domain 28 antibody, a disintegrin and metallopeptidase domain 28 antibody, Adam28 antibody, ADAM28 antibody

Background: Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.

Synonyms: ADAM28 | ADAM 28 | ADAM23 | eMDC II | eMDCII | MDC L | MDCL | Q9UKQ2

Gene ID: 10863