MMP11 antibody (N-Term)

Catalog No. ABIN5518777

Product Details anti-MMP11 Antibody

Target: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Binding Specificity: AA 104-135, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP11 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: RWEKTDLTYR ILRFPWQLVQ EQVRQTMAEA LK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: matrix metallopeptidase 11
Protein Name: Stromelysin-3

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-MMP11 antibody (ABIN5518777)

Zhang, Teng, Liu, Zhang, Liu: "Gene expression profile analyze the molecular mechanism of CXCR7 regulating papillary thyroid carcinoma growth and metastasis." in: Journal of experimental & clinical cancer research : CR, Vol. 34, pp. 16, (2015) (PubMed).

Target Details for MMP11

Target: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Alternative Name: MMP11 (MMP11 Products)

Synonyms: SL-3 antibody, ST3 antibody, STMY3 antibody, Stmy3 antibody, MMP-11 antibody, matrix metallopeptidase 11 antibody, matrix metallopeptidase 11 L homeolog antibody, stromelysin-3 antibody, MMP11 antibody, Mmp11 antibody, mmp11.L antibody, LOC103694874 antibody

Background: Stromelysin-3 (SL-3) also known as matrix metalloproteinase-11 (MMP-11) is an enzyme that in humans is encoded by the MMP11 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix.

Synonyms: MMP-11 | Mmp11 | SL 3 | SL-3 | SL3 | ST3 | STMY3 | Stromelysin 3 | Stromelysin III | Stromelysin-3 | P24347

Gene ID: 4320

UniProt: P24347