TNFAIP6 antibody (N-Term)

Catalog No. ABIN5518793

Product Details anti-TNFAIP6 Antibody

Target: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Binding Specificity: AA 46-91, N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNFAIP6 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Tumor necrosis factor-inducible gene 6 protein(TNFAIP6) detection. Tested with WB in Human,Rat.

Sequence: KYKLTYAEAK AVCEFEGGHL ATYKQLEAAR KIGFHVCAAG WMAKGR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Tumor necrosis factor-inducible gene 6 protein(TNFAIP6) detection. Tested with WB in Human,Rat.
Gene Name: TNF alpha induced protein 6
Protein Name: Tumor necrosis factor-inducible gene 6 protein

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for TNFAIP6

Target: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Alternative Name: TNFAIP6 (TNFAIP6 Products)

Synonyms: Tnfip6 antibody, TSG-6 antibody, Tsg6 antibody, TSG6 antibody, TNF alpha induced protein 6 antibody, tumor necrosis factor alpha induced protein 6 antibody, Tnfaip6 antibody, TNFAIP6 antibody

Background: Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.

Synonyms: TNFAIP 6 | Tnfaip6 | TSG 6 | TSG-6 | P98066

Gene ID: 7130

UniProt: P98066