TNFAIP6 antibody (N-Term)
-
- Target See all TNFAIP6 Antibodies
- TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))
-
Binding Specificity
- AA 46-91, N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNFAIP6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Tumor necrosis factor-inducible gene 6 protein(TNFAIP6) detection. Tested with WB in Human,Rat.
- Sequence
- KYKLTYAEAK AVCEFEGGHL ATYKQLEAAR KIGFHVCAAG WMAKGR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Tumor necrosis factor-inducible gene 6 protein(TNFAIP6) detection. Tested with WB in Human,Rat.
Gene Name: TNF alpha induced protein 6
Protein Name: Tumor necrosis factor-inducible gene 6 protein - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product TNFAIP6 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))
- Alternative Name
- TNFAIP6 (TNFAIP6 Products)
- Synonyms
- Tnfip6 antibody, TSG-6 antibody, Tsg6 antibody, TSG6 antibody, TNF alpha induced protein 6 antibody, tumor necrosis factor alpha induced protein 6 antibody, Tnfaip6 antibody, TNFAIP6 antibody
- Background
-
Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.
Synonyms: TNFAIP 6 | Tnfaip6 | TSG 6 | TSG-6 | P98066 - Gene ID
- 7130
- UniProt
- P98066
-