DVL3 antibody (Middle Region)
-
- Target See all DVL3 Antibodies
- DVL3 (Dishevelled, Dsh Homolog 3 (Drosophila) (DVL3))
-
Binding Specificity
- AA 397-434, Middle Region
-
Reactivity
- Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DVL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-3(DVL3) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- DTERLDDFHL SIHSDMAAIV KAMASPESGL EVRDRMW
- Cross-Reactivity (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Characteristics
-
Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-3(DVL3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: dishevelled segment polarity protein 3
Protein Name: Segment polarity protein dishevelled homolog DVL-3 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product DVL3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- DVL3 (Dishevelled, Dsh Homolog 3 (Drosophila) (DVL3))
- Alternative Name
- DVL3 (DVL3 Products)
- Synonyms
- dsh3 antibody, dvl3 antibody, wu:fb75f04 antibody, wu:fi22h02 antibody, wu:fp61b09 antibody, dishevelled segment polarity protein 3 L homeolog antibody, dishevelled segment polarity protein 3 antibody, dishevelled segment polarity protein 3a antibody, dvl3.L antibody, dvl3 antibody, DVL3 antibody, Dvl3 antibody, dvl3a antibody
- Background
-
Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
Synonyms: Dishevelled 3 | Dishevelled-3 | DSH homolog 3 | dvl3 | KIAA0208 | Q92997 - Gene ID
- 1857
- UniProt
- Q92997
-