ETS1 antibody (N-Term)

Catalog No. ABIN5518831

Product Details anti-ETS1 Antibody

Target: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Binding Specificity: AA 67-98, N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ETS1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Protein C-ets-1(ETS1) detection. Tested with WB in Human,Mouse.

Sequence: KDPRQWTETH VRDWVMWAVN EFSLKGVDFQ KF

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Protein C-ets-1(ETS1) detection. Tested with WB in Human,Mouse.
Gene Name: ETS proto-oncogene 1, transcription factor
Protein Name: Protein C-ets-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ETS1 (67-98aa KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-ETS1 antibody (ABIN5518831)

Bian, Xu, Zhu, Pan, Liu, Luo, Wu, Li: "Luteolin Inhibits Ischemia/Reperfusion-Induced Myocardial Injury in Rats via Downregulation of microRNA-208b-3p." in: PLoS ONE, Vol. 10, Issue 12, pp. e0144877, (2016) (PubMed).

Target Details for ETS1

Target: ETS1 (V-Ets erythroblastosis Virus E26 Oncogene Homolog 1 (Avian) (ETS1))

Alternative Name: ETS1 (ETS1 Products)

Synonyms: ETS-1 antibody, EWSR2 antibody, ets1a-a antibody, XE1-a antibody, X1-c-ets-1a antibody, ETS-1A antibody, ETS-1B antibody, TNIP1 antibody, c-ets-1 antibody, c-ets1 antibody, Ets-1 antibody, Etsoncb antibody, Tpl1 antibody, ets1 antibody, ets antibody, AI196000 antibody, AI448617 antibody, D230050P06 antibody, cb516 antibody, id:ibd1116 antibody, zgc:110573 antibody, XE1-b antibody, ets-1 antibody, ets1-B antibody, ETS proto-oncogene 1, transcription factor antibody, v-ets avian erythroblastosis virus E26 oncogene homolog 1 S homeolog antibody, v-ets avian erythroblastosis virus E26 oncogene homolog 1 antibody, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) antibody, E26 avian leukemia oncogene 1, 5' domain antibody, v-ets avian erythroblastosis virus E26 oncogene homolog 1 L homeolog antibody, ETS1 antibody, ets1.S antibody, Ets1 antibody, ets1 antibody, ets1.L antibody

Background: Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.

Synonyms: ETS 1 | Ets protein | ETS1 | ETS1 protein | EWSR 2 | EWSR2 | FLJ10768 | P54 | P14921

Gene ID: 2113

UniProt: P14921