PTGER4 antibody (C-Term)

Catalog No. ABIN5518866

Product Details anti-PTGER4 Antibody

Target: PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))

Binding Specificity: AA 311-345, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGER4 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Prostaglandin E2 receptor EP4 subtype(PTGER4) detection. Tested with WB in Human.

Sequence: DLQAIRIASV NPILDPWIYI LLRKTVLSKA IEKIK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Prostaglandin E2 receptor EP4 subtype(PTGER4) detection. Tested with WB in Human.
Gene Name: prostaglandin E receptor 4
Protein Name: Prostaglandin E2 receptor EP4 subtype

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PTGER4

Target: PTGER4 (Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4))

Alternative Name: PTGER4 (PTGER4 Products)

Synonyms: EP4 antibody, PGE2R-EP4 antibody, ptger4 antibody, ptger4l antibody, PTGER4 antibody, EP4R antibody, Ptgerep4 antibody, Ptger antibody, ep4 antibody, prostaglandin E receptor 4 antibody, prostaglandin E receptor 4 (subtype EP4) antibody, prostaglandin E receptor 4 (subtype EP4) a antibody, prostaglandin E receptor 4 subtype EP4 antibody, PTGER4 antibody, ptger4a antibody, ptger4 antibody, Ptger4 antibody

Background: Prostaglandin E2 receptor 4 (EP4) is a prostaglandin receptor encoded by the PTGER4 gene in humans. The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses.

Synonyms: EP 4 | EP4 | EP4R | PTGER 2 | PTGER2 | PTGER 4 | PTGER4 | P35408

Gene ID: 5734

UniProt: P35408