TFPI2 antibody (N-Term)

Catalog No. ABIN5518874

Product Details anti-TFPI2 Antibody

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Binding Specificity: AA 70-105, N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TFPI2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Tissue factor pathway inhibitor 2(TFPI2) detection. Tested with WB, IHC-P in Human,Mouse.

Sequence: EGNANNFYTW EACDDACWRI EKVPKVCRLQ VSVDDQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Tissue factor pathway inhibitor 2(TFPI2) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: tissue factor pathway inhibitor 2
Protein Name: Tissue factor pathway inhibitor 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TFPI2 (70-105aa EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for TFPI2

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Alternative Name: TFPI2 (TFPI2 Products)

Synonyms: MGC68843 antibody, TFPI2 antibody, MGC108301 antibody, si:ch211-262k23.2 antibody, tfpi2 antibody, PP5 antibody, REF1 antibody, TFPI-2 antibody, AV000670 antibody, PP5/TFPI-2 antibody, tissue factor pathway inhibitor 2 L homeolog antibody, tissue factor pathway inhibitor 2 antibody, tfpi2.L antibody, TFPI2 antibody, tfpi2 antibody, Tfpi2 antibody

Background: Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney.

Synonyms: Tissue factor pathway inhibitor 2 | TFPI-2 | Placental protein 5 | PP5 | TFPI2 | TFPI 2 | P48307

Gene ID: 7980

UniProt: P48307