HOXB1 antibody (C-Term)
-
- Target See all HOXB1 Antibodies
- HOXB1 (Homeobox B1 (HOXB1))
-
Binding Specificity
- AA 176-220, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HOXB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Homeobox protein Hox-B1(HOXB1) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- TARTFDWMKV KRNPPKTAKV SEPGLGSPSG LRTNFTTRQL TELEK
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Homeobox protein Hox-B1(HOXB1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: homeobox B1
Protein Name: Homeobox protein Hox-B1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1 (176-220aa TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK), different from the related mouse sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product HOXB1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HOXB1 (Homeobox B1 (HOXB1))
- Alternative Name
- HOXB1 (HOXB1 Products)
- Synonyms
- HCFP3 antibody, HOX2 antibody, HOX2I antibody, Hox-2.9 antibody, Z-3 antibody, hoxb1 antibody, id:ibd3532 antibody, Ghox-lab antibody, HOXB-1 antibody, XHox-b1 antibody, hox-2.9 antibody, hoxb-1 antibody, homeobox B1 antibody, homeobox B1a antibody, homeo box B1 antibody, homeobox protein Hox-B1a antibody, homeobox B1 L homeolog antibody, HOXB1 antibody, Hoxb1 antibody, hoxb1a antibody, LOC101062167 antibody, hoxb1.L antibody
- Background
-
Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
Synonyms: Homeobox protein Hox-B1, Homeobox protein Hox-2I, HOXB1, HOX2I - Gene ID
- 3211
- UniProt
- P14653
-