SLC6A1 antibody (N-Term)

Catalog No. ABIN5518957

Product Details anti-SLC6A1 Antibody

Target: SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))

Binding Specificity: AA 23-54, N-Term

Reactivity: Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC6A1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Sodium- and chloride-dependent GABA transporter 1(SLC6A1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: ANDKPKTLVV KVQKKAADLP DRDTWKGRFD FL

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for Sodium- and chloride-dependent GABA transporter 1(SLC6A1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: solute carrier family 6 member 1
Protein Name: Sodium- and chloride-dependent GABA transporter 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC6A1 (23-54aa ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for SLC6A1

Target: SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))

Alternative Name: SLC6A1 (GAT1 Products)

Synonyms: GABATHG antibody, GABATR antibody, GAT1 antibody, A730043E01 antibody, GAT-1 antibody, Gabt antibody, Gabt1 antibody, Gat1 antibody, XT-1 antibody, Xtrp1 antibody, si:ch211-280e18.1 antibody, si:dkey-164m14.1 antibody, slc6a1 antibody, solute carrier family 6 member 1 antibody, solute carrier family 6 (neurotransmitter transporter, GABA), member 1 antibody, solute carrier family 6 (neurotransmitter transporter, GABA), member 1, like antibody, GABA neurotransmitter transporter 1 antibody, SLC6A1 antibody, Slc6a1 antibody, slc6a1l antibody, slc6a1 antibody

Background: GABA transporter 1 (GAT1), also known as sodium- and chloride-dependent GABA transporter 1, is a protein that in humans is encoded by the SLC6A1 gene. GABA Transporter 1 uses Na+ and Cl- to create a gradient, which removes or adds GABA to extracellular spaces in the cerebrum and cerebellum. The stoichiometry for GABA Transporter 1 is 2 Na+: 1 Cl-: 1 GABA. The activity of GAT1 is largely dependent on the presence of Na+, while Cl- assists by increasing the ability for GAT-1 to uptake GABA.

Synonyms: Sodium- and chloride-dependent GABA transporter 1, GAT-1, Solute carrier family 6 member 1, SLC6A1, GABATR, GABT1, GAT1

Gene ID: 6529

UniProt: P30531