CDC20 antibody

Catalog No. ABIN5518976

Product Details anti-CDC20 Antibody

Target: CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDC20 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Cdc20 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: QTPTKKEHQK AWALNLNGFD VEEAKILRLS GKPQNAPEGY QNRLKVLYSQ KAT

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Cdc20 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cell division cycle 20
Protein Name: Cell division cycle protein 20 homolog

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human Cdc20 (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT).

Isotype: IgG

Application Details

Application Notes: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for CDC20

Target: CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))

Alternative Name: CDC20 (CDC20 Products)

Synonyms: X-FZY antibody, ba276h19.3 antibody, cdc20a antibody, fizzy1 antibody, p55cdc antibody, CDC20A antibody, bA276H19.3 antibody, p55CDC antibody, 2310042N09Rik antibody, C87100 antibody, cell division cycle 20 antibody, cell division cycle 20 L homeolog antibody, cell division cycle 20 homolog (S. cerevisiae) antibody, cdc20 antibody, CDC20 antibody, cdc20.L antibody, Cdc20 antibody

Background: The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This gene's most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.

Synonyms: Cell division cycle protein 20 homolog, p55CDC, CDC20

Gene ID: 991

UniProt: Q12834