FH antibody

Catalog No. ABIN5518986

Product Details anti-FH Antibody

Target: FH (Fumarate Hydratase (FH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for FH detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: YDKAAKIAKT AHKNGSTLKE TAIELGYLTA EQFDEWVKPK DMLGPK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for FH detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fumarate hydratase
Protein Name: Fumarate hydratase, mitochondrial

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).

Isotype: IgG

Application Details

Application Notes: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for FH

Target: FH (Fumarate Hydratase (FH))

Alternative Name: FH (FH Products)

Synonyms: FH antibody, DDBDRAFT_0205237 antibody, DDBDRAFT_0231397 antibody, DDBDRAFT_0231400 antibody, DDB_0205237 antibody, DDB_0231397 antibody, DDB_0231400 antibody, HLRCC antibody, LRCC antibody, MCL antibody, MCUL1 antibody, Fh1 antibody, im:7152785 antibody, ns:zf-e152 antibody, zf-e152 antibody, zgc:66253 antibody, zgc:77498 antibody, Fh antibody, Fh-1 antibody, fumarate hydratase antibody, fumarate hydratase 1 antibody, FH antibody, fumH antibody, Fh antibody, fh antibody, Fh1 antibody

Background: Fumarase (or fumaratehydratase) is an enzyme that catalyzes the reversible hydration/dehydration of fumarate to malate. Fumarase comes in two forms: mitochondrial and cytosolic. The mitochondrial isoenzyme is involved in the Krebs Cycle (also known as the Tricarboxylic Acid Cycle [TCA] or the Citric Acid Cycle), and the cytosolic isoenzyme is involved in the metabolism of amino acids and fumarate. Subcellular localization is established by the presence of a signal sequence on the amino terminus in the mitochondrial form, while subcellular localization in the cytosolic form is established by the absence of the signal sequence found in the mitochondrial variety. This enzyme participates in 2 metabolic pathways: citric acid cycle, reductive citric acid cycle (CO2 fixation), and is also important in renal cell carcinoma. Mutations in this gene have been associated with the development of leiomyomas in the skin and uterus in combination with renal cell carcinoma.

Synonyms: Fumarate hydratase, mitochondrial, Fumarase, FH,

Gene ID: 2271

UniProt: P07954