Relaxin 1 antibody

Catalog No. ABIN5519057

Product Details anti-Relaxin 1 Antibody

Target: Relaxin 1 (RLN1)

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Relaxin 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Relaxin 1 detection. Tested with WB, IHC-P in Human,Rat.

Sequence: VAAKWKDDVI KLCGRELVRA QIAICGMSTW S

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Relaxin 1 detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: relaxin 1
Protein Name: Prorelaxin H1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human Relaxin 1 (VAAKWKDDVIKLCGRELVRAQIAICGMSTWS).

Isotype: IgG

Application Details

Application Notes: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Relaxin 1

Target: Relaxin 1 (RLN1)

Alternative Name: RLN1 (RLN1 Products)

Synonyms: H1 antibody, H1RLX antibody, RLXH1 antibody, bA12D24.3.1 antibody, bA12D24.3.2 antibody, Rln antibody, rlx antibody, RELAX antibody, RLX1 antibody, RNL1 antibody, RLN1 antibody, RLX antibody, relaxin 1 antibody, RLN1 antibody, Rln1 antibody

Background: Relaxin 1 is a member of relaxin-like peptide family. Relaxin gene maps to human chromosome 19 near D19Mit23. Relaxin is a peptide hormone produced by the corpora lutea of ovaries during pregnancy in many mammalian species, including man. Relaxin widens the pubic bone and facilitates labor, it also softens the cervix (cervical ripening), and relaxes the uterine musculature. However, its significance may reach much further. Relaxin affects collagen metabolism, inhibiting collagen synthesis and enhancing its breakdown by increasing matrix metalloproteinases. It also enhances angiogenesis and is a potent renal vasodilator.

Synonyms: Prorelaxin H1, Relaxin B chain, Relaxin A chain, RLN1

Gene ID: 6013

UniProt: P04808