LYZL6 antibody

Catalog No. ABIN599863

Product Details anti-LYZL6 Antibody

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYZL6 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificity: Recognizes human Lysozyme-like 6.

Predicted Reactivity: Percent identity by BLAST analysis: Human, Gorilla (100%) Gibbon (97%) Monkey, Marmoset (90%).

Purification: Immunoaffinity purified

Immunogen: Lysozyme-like protein 6 Precursor recombinant protein epitope signature tag (PrEST), immunogen sequence CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP. Percent identity by BLAST analysis: Human, Gorilla (100%), Gibbon (97%), Monkey, Marmoset (90%).

Type of Immunogen: Recombinant protein

Isotype: IgG

Application Details

Application Notes: Approved: IHC, IHC-P

Usage: Suitable for use in Immunohistochemistry: Formalin-fixed, paraffin-embedded sections. Most normal tissues and malignant tissues were negative. Subsets of cells in seminiferous ducts expressed strong cytoplasmic positivity while the urothelium displayed moderate staining. Placenta, some of the glandular cells in gastrointestinal tract, epididymis and seminal vesicles showed weak staining. Occasional malignant carcinoids, urothelial and colorectal cancers showed weak to moderate staining.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS,  pH 7.2, 40 % glycerol, 0.02 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: May be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for at least 1 year at -20°C.

Target Details for LYZL6

Target: LYZL6 (Lysozyme-Like 6 (LYZL6))

Alternative Name: LYZL6 (LYZL6 Products)

Synonyms: LYC1 antibody, PRO1485 antibody, TKAL754 antibody, UNQ754 antibody, 1700023H08Rik antibody, Lyc1 antibody, RGD1306968 antibody, lysozyme like 6 antibody, lysozyme-like protein 6 antibody, lysozyme-like 6 antibody, LYZL6 antibody, LOC480492 antibody, Lyzl6 antibody

Background: Name/Gene ID: LYZL6

Synonyms: LYZL6, LYC1, Lysozyme homolog, PRO1485, Lysozyme-like 6, Lysozyme-like protein 6, TKAL754, UNQ754

Gene ID: 57151

UniProt: O75951