GMPR2 antibody (C-Term)

Catalog No. ABIN629588

Product Details anti-GMPR2 Antibody

Target: GMPR2 (Guanosine Monophosphate Reductase 2 (GMPR2))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GMPR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GMPR2 antibody was raised against the C terminal of GMPR2

Purification: Purified

Immunogen: GMPR2 antibody was raised using the C terminal of GMPR2 corresponding to a region with amino acids GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GMPR2 Blocking Peptide, catalog no. 33R-3152, is also available for use as a blocking control in assays to test for specificity of this GMPR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GMPR2

Target: GMPR2 (Guanosine Monophosphate Reductase 2 (GMPR2))

Alternative Name: GMPR2 (GMPR2 Products)

Synonyms: MGC81876 antibody, wu:fb63f02 antibody, zgc:136869 antibody, 1810008P16Rik antibody, 5730544D12Rik antibody, AA959850 antibody, guanosine monophosphate reductase 2 S homeolog antibody, guanosine monophosphate reductase 2 antibody, gmpr2.S antibody, guaC antibody, gmpr2 antibody, GMPR2 antibody, Gmpr2 antibody

Background: GMPR2 catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. It plays a role in modulating cellular differentiation.

Molecular Weight: 20 kDa (MW of target protein)