GMPR2 antibody (Guanosine Monophosphate Reductase 2) (C-Term)

Details for Product anti-GMPR2 Antibody No. ABIN629588, Supplier: Log in to see
Antigen
  • MGC81876
  • wu:fb63f02
  • zgc:136869
  • 1810008P16Rik
  • 5730544D12Rik
  • AA959850
  • guanosine monophosphate reductase 2
  • gmpr2
  • guaC
  • GMPR2
  • Gmpr2
Epitope
C-Term
7
3
3
1
Reactivity
Human, Mouse (Murine)
32
19
17
2
2
2
2
2
2
1
1
1
Host
Rabbit
28
4
Clonality
Polyclonal
Conjugate
This GMPR2 antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
18
13
4
3
3
2
2
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen GMPR2 antibody was raised using the C terminal of GMPR2 corresponding to a region with amino acids GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV
Specificity GMPR2 antibody was raised against the C terminal of GMPR2
Purification Purified
Alternative Name GMPR2 (GMPR2 Antibody Abstract)
Background GMPR2 catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. It plays a role in modulating cellular differentiation.
Molecular Weight 20 kDa (MW of target protein)
Research Area Chromatin and Nuclear Signaling, DNA/RNA, Differentiation, Developmental Biology
Application Notes WB: 5 µg/mL
Optimal conditions should be determined by the investigator.
Comment

GMPR2 Blocking Peptide, catalog no. 33R-3152, is also available for use as a blocking control in assays to test for specificity of this GMPR2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPR2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Western Blotting (WB) image for anti-Guanosine Monophosphate Reductase 2 (GMPR2) (C-Term) antibody (ABIN629588) GMPR2 antibody used at 5 ug/ml to detect target protein.
Did you look for something else?