CTP Synthase antibody (N-Term)
-
- Target See all CTP Synthase (CTPS) Antibodies
- CTP Synthase (CTPS)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CTP Synthase antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Ctp Synthase antibody was raised against the N terminal of CTPS
- Purification
- Purified
- Immunogen
- Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR
- Top Product
- Discover our top product CTPS Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Ctp Synthase Blocking Peptide, catalog no. 33R-8643, is also available for use as a blocking control in assays to test for specificity of this Ctp Synthase antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTPS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CTP Synthase (CTPS)
- Alternative Name
- Ctp Synthase (CTPS Products)
- Synonyms
- Ctps antibody, CTPS antibody, Ctps1 antibody, ctps antibody, ctps-b antibody, ctps1-b antibody, DDBDRAFT_0206047 antibody, DDBDRAFT_0230162 antibody, DDB_0206047 antibody, DDB_0230162 antibody, cb1040 antibody, ctps1 antibody, ctpsa antibody, wu:fb49e03 antibody, wu:fe17b03 antibody, ACYPI010091 antibody, An03g01310 antibody, CTP synthase antibody, CTP synthase 1 antibody, cytidine 5'-triphosphate synthase antibody, CTP synthase 1 L homeolog antibody, CTP synthase 1a antibody, CTP synthase PyrG antibody, CTP synthetase antibody, Ctps antibody, CTPS1 antibody, Ctps1 antibody, ctps1.L antibody, ctps antibody, ctps1a antibody, CNC00220 antibody, ANI_1_154034 antibody, ctps1 antibody, pyrG antibody, HMPREF0659_RS10035 antibody, Flexsi_0977 antibody
- Background
- The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development and tumorigenesis.
- Molecular Weight
- 67 kDa (MW of target protein)
- Pathways
- Proton Transport, Ribonucleoside Biosynthetic Process
-