CDY1 antibody (C-Term)

Catalog No. ABIN629620

Product Details anti-CDY1 Antibody

Target: CDY1 (Chromodomain Protein, Y-Linked, 1 (CDY1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDY1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDY1 antibody was raised against the C terminal of CDY1

Purification: Purified

Immunogen: CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDY1 Blocking Peptide, catalog no. 33R-3023, is also available for use as a blocking control in assays to test for specificity of this CDY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDY1

Target: CDY1 (Chromodomain Protein, Y-Linked, 1 (CDY1))

Alternative Name: CDY1 (CDY1 Products)

Synonyms: CDY antibody, CDY1A antibody, chromodomain Y-linked 1 antibody, CDY1 antibody

Background: CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.

Molecular Weight: 62 kDa (MW of target protein)