RNF38 antibody (N-Term)
-
- Target See all RNF38 Antibodies
- RNF38 (Ring Finger Protein 38 (RNF38))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF38 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF38 antibody was raised against the N terminal of RNF38
- Purification
- Purified
- Immunogen
- RNF38 antibody was raised using the N terminal of RNF38 corresponding to a region with amino acids FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP
- Top Product
- Discover our top product RNF38 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF38 Blocking Peptide, catalog no. 33R-2874, is also available for use as a blocking control in assays to test for specificity of this RNF38 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF38 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF38 (Ring Finger Protein 38 (RNF38))
- Alternative Name
- RNF38 (RNF38 Products)
- Synonyms
- 1700065B19Rik antibody, 2610202O07Rik antibody, AA673263 antibody, Oip1 antibody, ring finger protein 38 L homeolog antibody, ring finger protein 38 antibody, rnf38.L antibody, RNF38 antibody, Rnf38 antibody
- Background
- RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.
- Molecular Weight
- 51 kDa (MW of target protein)
-