RNF38 antibody (N-Term)

Catalog No. ABIN629634

Product Details anti-RNF38 Antibody

Target: RNF38 (Ring Finger Protein 38 (RNF38))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF38 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF38 antibody was raised against the N terminal of RNF38

Purification: Purified

Immunogen: RNF38 antibody was raised using the N terminal of RNF38 corresponding to a region with amino acids FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF38 Blocking Peptide, catalog no. 33R-2874, is also available for use as a blocking control in assays to test for specificity of this RNF38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF38

Target: RNF38 (Ring Finger Protein 38 (RNF38))

Alternative Name: RNF38 (RNF38 Products)

Synonyms: 1700065B19Rik antibody, 2610202O07Rik antibody, AA673263 antibody, Oip1 antibody, ring finger protein 38 L homeolog antibody, ring finger protein 38 antibody, rnf38.L antibody, RNF38 antibody, Rnf38 antibody

Background: RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.

Molecular Weight: 51 kDa (MW of target protein)