FAH antibody

Catalog No. ABIN629635

Product Details anti-FAH Antibody

Target: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAH Blocking Peptide, catalog no. 33R-1054, is also available for use as a blocking control in assays to test for specificity of this FAH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAH

Target: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Alternative Name: FAH (FAH Products)

Synonyms: CG14993 antibody, Dmel\\CG14993 antibody, dfaa antibody, l(3)64Al antibody, l(3)SH11 antibody, PSPTO3550 antibody, fb59b12 antibody, wu:fb59b12 antibody, zgc:55316 antibody, FAA antibody, Fumarylacetoacetase antibody, FumarylAcetoacetate Hydrolase antibody, fumarylacetoacetase antibody, fumarylacetoacetate hydrolase antibody, fumarylacetoacetate hydrolase (fumarylacetoacetase) antibody, fumarylacetoacetate hydrolase (fumarylacetoacetase) L homeolog antibody, Faa antibody, fah-1 antibody, fahA antibody, hmgB antibody, Ndas_1870 antibody, Lbys_3503 antibody, Riean_0663 antibody, Ftrac_0820 antibody, Celal_3675 antibody, Celly_2655 antibody, Weevi_0208 antibody, Fluta_2435 antibody, Halhy_2019 antibody, Lacal_2931 antibody, FsymDg_1892 antibody, Fah antibody, fah antibody, fah.L antibody, FAH antibody

Background: FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.

Molecular Weight: 46 kDa (MW of target protein)