WDR12 antibody (C-Term)

Catalog No. ABIN629636

Product Details anti-WDR12 Antibody

Target: WDR12 (WD Repeat Domain 12 (WDR12))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR12 antibody was raised against the C terminal of WDR12

Purification: Purified

Immunogen: WDR12 antibody was raised using the C terminal of WDR12 corresponding to a region with amino acids DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR12 Blocking Peptide, catalog no. 33R-2209, is also available for use as a blocking control in assays to test for specificity of this WDR12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR12

Target: WDR12 (WD Repeat Domain 12 (WDR12))

Alternative Name: WDR12 (WDR12 Products)

Synonyms: WDR12 antibody, YTM1 antibody, 4933402C23Rik antibody, Ytm1 antibody, Ytm1p antibody, fb24f09 antibody, wu:fb24f09 antibody, zgc:55609 antibody, WD repeat domain 12 antibody, WDR12 antibody, Wdr12 antibody, wdr12 antibody

Background: WDR12 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The function of this protein is not known.

Molecular Weight: 47 kDa (MW of target protein)