PDSS1 antibody

Catalog No. ABIN629662

Product Details anti-PDSS1 Antibody

Target: PDSS1 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 1 (PDSS1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDSS1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PDSS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDSS1 Blocking Peptide, catalog no. 33R-3225, is also available for use as a blocking control in assays to test for specificity of this PDSS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDSS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDSS1

Target: PDSS1 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 1 (PDSS1))

Alternative Name: PDSS1 (PDSS1 Products)

Synonyms: COQ1 antibody, COQ10D2 antibody, DPS antibody, RP13-16H11.3 antibody, SPS antibody, TPRT antibody, TPT antibody, TPT 1 antibody, hDPS1 antibody, 2610203G20Rik antibody, 2700031G06Rik antibody, Tprt antibody, mDLP1 antibody, mSPS1 antibody, tprt antibody, wu:fc11f12 antibody, wu:fd05d05 antibody, zgc:112058 antibody, T30F21.15 antibody, T30F21_15 antibody, solanesyl diphosphate synthase 1 antibody, decaprenyl diphosphate synthase subunit 1 antibody, prenyl (solanesyl) diphosphate synthase, subunit 1 antibody, prenyl (decaprenyl) diphosphate synthase, subunit 1 antibody, solanesyl diphosphate synthase 1 antibody, PDSS1 antibody, Pdss1 antibody, pdss1 antibody, SPS1 antibody

Background: PDSS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. PDSS1 catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in PDSS1 gene are a cause of coenzyme Q10 deficiency.

Molecular Weight: 46 kDa (MW of target protein)