NFS1 antibody

Catalog No. ABIN629670

Product Details anti-NFS1 Antibody

Target: NFS1 (NFS1, Cysteine Desulfurase (NFS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NFS1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV

Application Details

Application Notes: WB: 0.3125 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NFS1 Blocking Peptide, catalog no. 33R-9331, is also available for use as a blocking control in assays to test for specificity of this NFS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NFS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NFS1

Target: NFS1 (NFS1, Cysteine Desulfurase (NFS1))

Alternative Name: NFS1 (NFS1 Products)

Synonyms: ARABIDOPSIS THALIANA NITROGEN FIXATION S (NIFS)-LIKE 1 antibody, ATNFS1 antibody, ATNIFS1 antibody, CYSTEINE DESULFURASE antibody, MPA24.7 antibody, MPA24_7 antibody, NIFS1 antibody, NITROGEN FIXATION S HOMOLOG 1 antibody, nitrogen fixation S (NIFS)-like 1 antibody, IscS antibody, NIFS antibody, Nifs antibody, NFS1 antibody, AA987187 antibody, m-Nfs1 antibody, m-Nfsl antibody, fb50g03 antibody, wu:fb50g03 antibody, aminotransferase family protein (LolT) antibody, cysteine desulfurase, (m-Nfs1) antibody, nitrogen fixation S (NIFS)-like 1 antibody, cysteine desulfurase antibody, NFS1, cysteine desulfurase antibody, NFS1 cysteine desulfurase antibody, nitrogen fixation gene 1 (S. cerevisiae) antibody, AOR_1_546014 antibody, trd_A0109 antibody, NFS1 antibody, Arnit_0871 antibody, Fbal_3329 antibody, Nfs1 antibody, nfs1 antibody

Background: Iron-sulfur clusters are required for the function of many cellular enzymes. The protein encoded by this geneupplies inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis