AMFR antibody (C-Term)

Catalog No. ABIN629722

Product Details anti-AMFR Antibody

Target: AMFR (Autocrine Motility Factor Receptor (AMFR))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AMFR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AMFR antibody was raised against the C terminal of AMFR

Purification: Purified

Immunogen: AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AMFR Blocking Peptide, catalog no. 33R-2901, is also available for use as a blocking control in assays to test for specificity of this AMFR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMFR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AMFR

Target: AMFR (Autocrine Motility Factor Receptor (AMFR))

Alternative Name: AMFR (AMFR Products)

Synonyms: GP78 antibody, RNF45 antibody, gp78 antibody, wu:fi06e06 antibody, wu:fi37e05 antibody, zgc:63893 antibody, rnf45 antibody, autocrine motility factor receptor antibody, autocrine motility factor receptor L homeolog antibody, autocrine motility factor receptor a antibody, autocrine motility factor receptor, amfr antibody, putative autocrine motility factor receptor, amfr antibody, AMFR antibody, Amfr antibody, amfr.L antibody, amfra antibody, amfr antibody, AaeL_AAEL005881 antibody, CpipJ_CPIJ016043 antibody, Smp_047420 antibody

Background: Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.

Molecular Weight: 53 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling