RNF165 antibody (N-Term)
-
- Target See all RNF165 Antibodies
- RNF165 (Ring Finger Protein 165 (RNF165))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNF165 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RNF165 antibody was raised against the N terminal of RNF165
- Purification
- Purified
- Immunogen
- RNF165 antibody was raised using the N terminal of RNF165 corresponding to a region with amino acids MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP
- Top Product
- Discover our top product RNF165 Primary Antibody
-
anti-Ring Finger Protein 165 (RNF165) (Middle Region) antibody
RNF165 Reactivity: Human, Mouse, Rat, Dog, Rabbit, Guinea Pig, Horse, Cow, Zebrafish (Danio rerio) WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Ring Finger Protein 165 (RNF165) (AA 3-31), (N-Term) antibodyRNF165 Reactivity: Human WB Host: Rabbit Polyclonal RB37753 unconjugated
anti-Ring Finger Protein 165 (RNF165) (N-Term) antibodyRNF165 Reactivity: Human, Mouse, Rat, Rabbit, Guinea Pig, Horse, Chicken, Monkey, Bat WB Host: Rabbit Polyclonal unconjugated
anti-Ring Finger Protein 165 (RNF165) (AA 201-250) antibodyRNF165 Reactivity: Human, Mouse, Rat, Dog, Rabbit, Guinea Pig, Horse, Cow, Chicken, Monkey, Pig WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNF165 Blocking Peptide, catalog no. 33R-6596, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF165 (Ring Finger Protein 165 (RNF165))
- Alternative Name
- RNF165 (RNF165 Products)
- Synonyms
- RNF165 antibody, ARKL2 antibody, 2900024M11Rik antibody, AI427432 antibody, G630064H08Rik antibody, Gm96 antibody, RGD1560744 antibody, si:ch73-29c22.3 antibody, ring finger protein 165 antibody, ring finger protein 165a antibody, RNF165 antibody, Rnf165 antibody, rnf165a antibody
- Background
- RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.
- Molecular Weight
- 39 kDa (MW of target protein)
-
