GSTZ1 antibody

Catalog No. ABIN629755

Product Details anti-GSTZ1 Antibody

Target: GSTZ1 (Glutathione Transferase zeta 1 (Maleylacetoacetate Isomerase) (GSTZ1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSTZ1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: GSTZ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSTZ1 Blocking Peptide, catalog no. 33R-6317, is also available for use as a blocking control in assays to test for specificity of this GSTZ1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTZ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSTZ1

Target: GSTZ1 (Glutathione Transferase zeta 1 (Maleylacetoacetate Isomerase) (GSTZ1))

Alternative Name: GSTZ1 (GSTZ1 Products)

Synonyms: GSTZ1-1 antibody, MAAI antibody, MAI antibody, zgc:113898 antibody, zgc:92869 antibody, PSPTO3554 antibody, DDBDRAFT_0204466 antibody, DDBDRAFT_0231608 antibody, DDB_0204466 antibody, DDB_0231608 antibody, CG9362 antibody, Dmel\CG9362 antibody, gstz1 antibody, glutathione S-transferase zeta 1 antibody, glutathione transferase zeta 1 (maleylacetoacetate isomerase) antibody, maleylacetoacetate isomerase antibody, Glutathione S transferase Z1 antibody, glutathione S-transferase zeta 1 L homeolog antibody, GSTZ1 antibody, Gstz1 antibody, gstz1 antibody, maiA antibody, hmgC antibody, Patl_1448 antibody, Pnap_2807 antibody, Bind_0562 antibody, Bphyt_0577 antibody, Dtpsy_1678 antibody, Hbal_2638 antibody, mai antibody, BC1002_0299 antibody, Fbal_2576 antibody, Mesop_3937 antibody, GstZ1 antibody, gstz1.L antibody

Background: GSTZ1 is a member of the glutathione S-transferase (GSTs) super-family which are important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia.

Molecular Weight: 24 kDa (MW of target protein)