ITGB1BP2 antibody

Catalog No. ABIN629756

Product Details anti-ITGB1BP2 Antibody

Target: ITGB1BP2 (Integrin beta 1 Binding Protein (Melusin) 2 (ITGB1BP2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ITGB1BP2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: ITGB1 BP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ITGB1BP2 Blocking Peptide, catalog no. 33R-6461, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ITGB1BP2

Target: ITGB1BP2 (Integrin beta 1 Binding Protein (Melusin) 2 (ITGB1BP2))

Alternative Name: ITGB1BP2 (ITGB1BP2 Products)

Synonyms: CHORDC3 antibody, ITGB1BP antibody, MELUSIN antibody, Chordc3 antibody, RGD1565015 antibody, integrin subunit beta 1 binding protein 2 antibody, integrin beta 1 binding protein 2 antibody, ITGB1BP2 antibody, Itgb1bp2 antibody

Background: ITGB1BP2 may play a role during maturation and/or organization of muscles cells.

Molecular Weight: 38 kDa (MW of target protein)