HSD17B6 antibody (N-Term)

Catalog No. ABIN629831

Product Details anti-HSD17B6 Antibody

Target: HSD17B6 (Hydroxysteroid (17-Beta) Dehydrogenase 6 (HSD17B6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD17B6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: HSD17 B6 antibody was raised against the N terminal of HSD17 6

Purification: Purified

Immunogen: HSD17 B6 antibody was raised using the N terminal of HSD17 6 corresponding to a region with amino acids MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSD17B6 Blocking Peptide, catalog no. 33R-6617, is also available for use as a blocking control in assays to test for specificity of this HSD17B6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSD17B6

Target: HSD17B6 (Hydroxysteroid (17-Beta) Dehydrogenase 6 (HSD17B6))

Alternative Name: HSD17B6 (HSD17B6 Products)

Synonyms: HSE antibody, RODH antibody, SDR9C6 antibody, 17betaHSD9 antibody, Hsd17b9 antibody, Rdh8 antibody, hydroxysteroid 17-beta dehydrogenase 6 antibody, hydroxysteroid (17-beta) dehydrogenase 6 antibody, HSD17B6 antibody, Hsd17b6 antibody

Background: HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis