GGTLC1 antibody (C-Term)
-
- Target See all GGTLC1 Antibodies
- GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Dog, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GGTLC1 antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificity
- GGTLA4 antibody was raised against the C terminal of GGTLA4
- Purification
- Purified
- Immunogen
- GGTLA4 antibody was raised using the C terminal of GGTLA4 corresponding to a region with amino acids DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
- Top Product
- Discover our top product GGTLC1 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GGTLA4 Blocking Peptide, catalog no. 33R-2128, is also available for use as a blocking control in assays to test for specificity of this GGTLA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTLA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))
- Alternative Name
- GGTLA4 (GGTLC1 Products)
- Synonyms
- GGTL6 antibody, GGTLA3 antibody, GGTLA4 antibody, dJ831C21.1 antibody, dJ831C21.2 antibody, gamma-glutamyltransferase light chain 1 antibody, GGTLC1 antibody
- Background
- Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione.
- Molecular Weight
- 25 kDa (MW of target protein)
-