NXF1 antibody (N-Term)

Catalog No. ABIN629896

Product Details anti-NXF1 Antibody

Target: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NXF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: NXF1 antibody was raised against the N terminal of NXF1

Purification: Purified

Immunogen: NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NXF1 Blocking Peptide, catalog no. 33R-5618, is also available for use as a blocking control in assays to test for specificity of this NXF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NXF1

Target: NXF1 (Nuclear RNA Export Factor 1 (NXF1))

Alternative Name: NXF1 (NXF1 Products)

Synonyms: im:7156527 antibody, wu:fc12d06 antibody, MGC82224 antibody, NXF1 antibody, tap antibody, mex67 antibody, MEX67 antibody, TAP antibody, Mex67 antibody, Mvb1 antibody, Tap antibody, Mex67h antibody, nuclear RNA export factor 1 antibody, nuclear RNA export factor 1 S homeolog antibody, Nuclear RNA export factor 1 antibody, nxf1 antibody, nxf1.S antibody, NXF1 antibody, LOC100113601 antibody, Tsp_03999 antibody, Nxf1 antibody, nxf-1 antibody

Background: NXF1 is one member of a family of nuclear RNA export factor. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. NXF1 overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.

Molecular Weight: 68 kDa (MW of target protein)