EXOSC4 antibody (N-Term)

Catalog No. ABIN629903

Product Details anti-EXOSC4 Antibody

Target: EXOSC4 (Exosome Component 4 (EXOSC4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOSC4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: EXOSC4 antibody was raised against the N terminal of EXOSC4

Purification: Purified

Immunogen: EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOSC4 Blocking Peptide, catalog no. 33R-8366, is also available for use as a blocking control in assays to test for specificity of this EXOSC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOSC4

Target: EXOSC4 (Exosome Component 4 (EXOSC4))

Alternative Name: EXOSC4 (EXOSC4 Products)

Synonyms: EXOSC4 antibody, zgc:73175 antibody, RRP41 antibody, RRP41A antibody, Rrp41p antibody, SKI6 antibody, Ski6p antibody, hRrp41p antibody, p12A antibody, 1110039I09Rik antibody, 1500001N04Rik antibody, Rrp41 antibody, exosome component 4 antibody, exosome component 4 S homeolog antibody, exosc4 antibody, EXOSC4 antibody, CC1G_03561 antibody, exosc4.S antibody, Exosc4 antibody

Background: EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.

Molecular Weight: 27 kDa (MW of target protein)